GET /api/protein/UniProt/I1NEJ1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I1NEJ1",
"id": "I1NEJ1_SOYBN",
"source_organism": {
"taxId": "3847",
"scientificName": "Glycine max",
"fullName": "Glycine max (Soybean)"
},
"name": "Dirigent protein",
"description": [
"Dirigent proteins impart stereoselectivity on the phenoxy radical-coupling reaction, yielding optically active lignans from two molecules of coniferyl alcohol in the biosynthesis of lignans, flavonolignans, and alkaloids and thus plays a central role in plant secondary metabolism"
],
"length": 264,
"sequence": "MASTSQTLGNKIAMGMGSLTAASLAMLLAFANLATTIAAVDPTAATGKEHVIELYMHDILGGSNPTARPVTGLLGSIYSGQVPFAMPVGFNTQGTAIPNANGANPTVNGVFGIPLGTGLAGTSFAPNSGNNNNQNNAPLQLGPDGLGLGFGTITVIDDILTSQPELGSQIVGKAQGVYVASSADGTRQMMAFTALFEGGEYGDSLNFYGLYKIGSTMSQISVMGGTGKFKNARGFAELRALIPPGQIATDGAETLLRITIYLKH",
"proteome": "UP000008827",
"gene": "LOC100810393",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3d4a9bb835893a45d07f9261782f557ffe98e74b",
"counters": {
"domain_architectures": 16083,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 16083
}
}
}