General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "I1MYJ1",
        "id": "I1MYJ1_SOYBN",
        "source_organism": {
            "taxId": "3847",
            "scientificName": "Glycine max",
            "fullName": "Glycine max (Soybean)"
        },
        "name": "Mitotic spindle checkpoint protein MAD2",
        "description": [
            "Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and delays the onset of anaphase when this process is not complete. It inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate"
        ],
        "length": 207,
        "sequence": "MAARTVAKDIITLRGSAAIVSEFFGYAANSILYNRGVYPEESFVKVKKYGLPMLLTEDEGVKSFLANLTAQLSEWLEAGKLQRVVLVIMSKATSEVLERWNFSIETDSEVVEKGVSREKSDKEIMREIQAIMRQIASSITYLPCLDEPCVFDVLAYTDKDVAVPFTWVESDPKLIANPQMVKLHSFDTKIHKVDTLVSYKNDEWDEQ",
        "proteome": "UP000008827",
        "gene": "LOC100789307",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "df516b15991961959fae032d9f85e4f5ed08fa46",
        "counters": {
            "domain_architectures": 11437,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11437
        }
    }
}