GET /api/protein/UniProt/I1LQJ3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "I1LQJ3",
"id": "I1LQJ3_SOYBN",
"source_organism": {
"taxId": "3847",
"scientificName": "Glycine max",
"fullName": "Glycine max (Soybean)"
},
"name": "RRM domain-containing protein",
"description": [
"Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation"
],
"length": 353,
"sequence": "MVATAIEEVRTLWIGDLQYWVDESYLSQCFAHSGEVVSIKIIRNKLTGQPEGYGFVEFVSHASAEAFLRTFNGAQMPGTDQTFRLNWASFGDSGPDHSIFVGDLAPDVTDFILQETFRAHYPSVKGSKVVTDPATGRSKGYGFVKFADEAQRNRAMTEMNGVYCSTRPMRISAATPKKNASFQHQYAPPKAMYQFPAYTAPVSTVAPENDVNNTTVCIGNLDLNVTEEELKQAFVQFGDIVLVKIYAGKGYGYVQFGTRASAEDAIQRMQGKVIGQQVIQISWGSTLTARQDVPGGWGAQMDPSQWSAYYGYGQGYESYAYGATHDPSLYAYGAYAGYAQYPQNVSLHTHGRE",
"proteome": "UP000008827",
"gene": "LOC100813616",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003729",
"name": "mRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1d8d02f5f54dae87c0a5dfa9c17a8ccb9f1ee753",
"counters": {
"domain_architectures": 50304,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"cdd": 2,
"pfam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 50304
}
}
}