HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H9HA20",
"id": "H9HA20_NOMLE",
"source_organism": {
"taxId": "61853",
"scientificName": "Nomascus leucogenys",
"fullName": "Nomascus leucogenys (Northern white-cheeked gibbon)"
},
"name": "Interleukin-11 receptor subunit alpha",
"description": [
"Receptor for interleukin-11 (IL11). The receptor systems for IL6, LIF, OSM, CNTF, IL11 and CT1 can utilize IL6ST for initiating signal transmission. The IL11/IL11RA/IL6ST complex may be involved in the control of proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells. Essential for the normal development of craniofacial bones and teeth. Restricts suture fusion and tooth number",
"Soluble form of IL11 receptor (sIL11RA) that acts as an agonist of IL11 activity. The IL11:sIL11RA complex binds to IL6ST/gp130 on cell surfaces and induces signaling also on cells that do not express membrane-bound IL11RA in a process called IL11 trans-signaling"
],
"length": 422,
"sequence": "MSSSCSGLSRVLVAVATALVSASSPCSQAWGPPGVQYGQPGRSMKLCCPGVTAGEPVSWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICRTLDGALGGTVTLQLGYPSARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRKSLSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPRQPHFLLKFRLQYRPAQHPAWSMVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTVPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHKDSVEQVAVLASLGILSFLGLVAGALALGLWLRLRQGGKDGSPKPGFLASMIPVDRHPGAPNL",
"proteome": "UP000001073",
"gene": "IL11RA",
"go_terms": [
{
"identifier": "GO:0005515",
"name": "protein binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004896",
"name": "cytokine receptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": null,
"counters": {
"domain_architectures": 0,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"smart": 2,
"profile": 2,
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1
}
}
}