HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H9G9T3",
"id": "H9G9T3_ANOCA",
"source_organism": {
"taxId": "28377",
"scientificName": "Anolis carolinensis",
"fullName": "Anolis carolinensis (Green anole)"
},
"name": "Uncharacterized protein",
"description": null,
"length": 494,
"sequence": "MELSGAVTLFLVIYLSCLAIVSFKRKLSSKGRLPPGPTPLPLIGNFLQIKSLEILKSLLKLSEIYGPVFTVYFGTRPIVVLCGHDAVKEALIDKADEFSGRATNPTLERTFKGHGVAFANGERWKQLRRFSLNVLRHFGMGKKSIQERIQEEAQFLLEEFRKTKEKPFDPTYFLSRTVSNVICSIIFGDRFDYEDKEFQSLMEMINITFREMSSGQAQFYDMYVSFLKYFPGPPVKVYDSLENMRLFIAKKVKKNKDTFDPNFQRDFIDCFLNQMEKEKNKPASEFHDRNLELTTLNLFVAGTETVSSTLRYGFLFLMKHPEVQAKVHEEIDRVIGHNRVPNIEDRSQMPYMDAVIHEIQRCSDLIPMDVAHRVICDTEFRGYIIPKGTEIYPILSSVLHDPTMFKRPFAFDPENFLDENGRFKKNDAFVPFSSGKRICLGEALARMELFLFFTTILQSFQLKSLVPPEDINIIPQESGFATIPPFYQLSVIPR",
"proteome": "UP000001646",
"gene": "LOC100556452",
"go_terms": [
{
"identifier": "GO:0004497",
"name": "monooxygenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005506",
"name": "iron ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016705",
"name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016712",
"name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a02e61ba6c64bb9a9c779746e03a6c43264a16fb",
"counters": {
"domain_architectures": 520850,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prints": 3,
"prosite": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 520850
}
}
}