General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H9G819",
        "id": "H9G819_ANOCA",
        "source_organism": {
            "taxId": "28377",
            "scientificName": "Anolis carolinensis",
            "fullName": "Anolis carolinensis (Green anole)"
        },
        "name": "Serum response factor-binding protein 1",
        "description": [
            "May be involved in regulating transcriptional activation of cardiac genes during the aging process. May play a role in biosynthesis and/or processing of SLC2A4 in adipose cells"
        ],
        "length": 429,
        "sequence": "MAQVLNLNNEVVKMRKEVKKIKVLTIRKLTRHIAKLKSKKGTEEEVLKNQKRVQRLLEEIQAMKEIKPDQVTKLALGKDIDFEIICKMPNCTAKDRAIARLSAHPLLKTKIADIKAAVKAFKDARLKPSRTVSSEEHKSEEQLTKQPEETQHSSNREQNKTFKQAEHQNKIKVKEKPGTVMGKEQISVLEEQKKDTEQQCPVDDFPLQEGEHPKLAHQVQTVQTDHTICPEGEKCLGDLHSRADESDSDQSQSEESGTVKEYFDDSTEERFYNQSSDSEKSDSNDDFFIGKVKRTKKRAMADISIPREEKKGIMFKTSKSVMVQDTDTKHNSQKSKAANLDSVFYCSLSNSDKSKNVKRTSRDSLPRNKSTFEKSHPQKQKHKGLGMRRDEGKKQLEQALHPSWEASRKRREQVSQITAFQGKKIIFED",
        "proteome": "UP000001646",
        "gene": "SRFBP1",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "17301101ca42f9e08bf98a5b5ec2fcda41a6be74",
        "counters": {
            "domain_architectures": 2537,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2537
        }
    }
}