General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H9FN74",
        "id": "H9FN74_MACMU",
        "source_organism": {
            "taxId": "9544",
            "scientificName": "Macaca mulatta",
            "fullName": "Macaca mulatta (Rhesus macaque)"
        },
        "name": "L antigen family member 3",
        "description": [
            "Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. LAGE3 functions as a dimerization module for the complex"
        ],
        "length": 143,
        "sequence": "MWEAEADAGGGADGGDGQGGHSFPGGADTAAAPASGAPPPHAPGPGRDAASAARGPGMRPHIFTLSVPFPTPLEAEIAHGSLAPDAEPHQRVVGKELTVSGRILAIRWKAEDCRLLRISVINFLDQLSLVVRTMQRFGPPVSR",
        "proteome": "UP000006718",
        "gene": "LAGE3",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "db680613c6fa3f15b4902a308d927c13a037b7af",
        "counters": {
            "domain_architectures": 4639,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4639
        }
    }
}