HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H8X7X4",
"id": "H8X7X4_CANO9",
"source_organism": {
"taxId": "1136231",
"scientificName": "Candida orthopsilosis (strain 90-125)",
"fullName": "Candida orthopsilosis (strain 90-125) (Yeast)"
},
"name": "Large ribosomal subunit protein uL14m",
"description": [
"Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane"
],
"length": 136,
"sequence": "MIYLKTLLNVIDNSGAQVVECIKVLRHNPKSCAHIGDQITCVVKQARPTNVDSSSASSAAQASNRVKRRDICRAVVVRQRAPFRRPDGSVVRFDDNACVLINKNGEPLGTRISSVVAKELRDLNYNKIVSLAPKTF",
"proteome": "UP000005018",
"gene": "CORT_0E04890",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015934",
"name": "large ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bfe0eecd917e299541388c0abf6635e43a3ce085",
"counters": {
"domain_architectures": 48983,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"smart": 1,
"cdd": 1,
"ncbifam": 1,
"panther": 1,
"hamap": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 48983
}
}
}