HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H8X3Y9",
"id": "H8X3Y9_CANO9",
"source_organism": {
"taxId": "1136231",
"scientificName": "Candida orthopsilosis (strain 90-125)",
"fullName": "Candida orthopsilosis (strain 90-125) (Yeast)"
},
"name": "Uracil-DNA glycosylase",
"description": [
"Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine"
],
"length": 332,
"sequence": "MTAKRSLITDYFSQVGGTVKKCKPAHTSKVDEKPKVIPETKPRETKPPTKNPSLEFTSFNKQEWINSLTSEQKELLQLEIDTLHISWLSMLYKELTKPYFLNLKKFLQSQQKQGKTIFPKPQHIYSWSNLTPLPNVKCLILGQDPYHNHNQAHGLAFSVLEPTRPPPSLINIYKTLTIDYPDTFRVPDYQELLKQGKPGGGNLTKWATNGGVLMLNAVLTVEAHKANSHANQGWEQFTEQVIRVALEYHQKHKSGFVIMAWGTPAQKRLKPFEKMLTKNSTSGNGNDQFLVLKTVHPSPLSAHRGFFNSQVFKKCNDWLEKHNRDVIDWSVY",
"proteome": "UP000005018",
"gene": "UNG1",
"go_terms": [
{
"identifier": "GO:0004844",
"name": "uracil DNA N-glycosylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006284",
"name": "base-excision repair",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6d3eb109c1e174cd82c598bd72ab8f3ce4283767",
"counters": {
"domain_architectures": 69726,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"smart": 2,
"pfam": 1,
"panther": 1,
"ncbifam": 4,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 69726
}
}
}