General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H7BZW7",
        "id": "H7BZW7_HUMAN",
        "source_organism": {
            "taxId": "9606",
            "scientificName": "Homo sapiens",
            "fullName": "Homo sapiens (Human)"
        },
        "name": "Translation initiation factor eIF2 assembly protein",
        "description": [
            "ATP-dependent protein-folding chaperone for the eIF2 complex. Binds to the gamma subunit of the eIF2 complex which allows the subunit to assemble with the alpha and beta subunits"
        ],
        "length": 144,
        "sequence": "MFIHCTDDSPDPCIEYELVLRKWCELIPGAEFRCFVKENKLIGISQRDYTQYYDHISKQKEEIRRCIQDFFKKHIQYKFLDEDFVFDIYRDSRGKVWLIDFNPFGEVTDSLLFTWEELISENNLNGDFSEVDAQEQKRNQQEDD",
        "proteome": "UP000005640",
        "gene": "CDC123",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "fb869371a4a7774f3dbab700dbfd523fbf2342fc",
        "counters": {
            "domain_architectures": 4862,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4862
        }
    }
}