GET /api/protein/UniProt/H6R5Z9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H6R5Z9",
        "id": "H6R5Z9_NOCCG",
        "source_organism": {
            "taxId": "1127134",
            "scientificName": "Nocardia cyriacigeorgica (strain GUH-2)",
            "fullName": "Nocardia cyriacigeorgica (strain GUH-2)"
        },
        "name": "Phosphoenolpyruvate guanylyltransferase",
        "description": [
            "Guanylyltransferase that catalyzes the activation of phosphoenolpyruvate (PEP) as enolpyruvoyl-2-diphospho-5'-guanosine, via the condensation of PEP with GTP. It is involved in the biosynthesis of coenzyme F420, a hydride carrier cofactor"
        ],
        "length": 231,
        "sequence": "MRSHTVHAVIAVKSLDRAKSRLADRLPPRERASLVLAMFTDTVRAATAVAQLASVTVVTPDPAVAERAGRLGALVHPEPMTGPGGPGDPDGLNSALRTAADELRHRHGPVDVLALQADLPALRPDELAGMLATAPRDARSVVVDHAGTGTAALLARAAVPLEPAFGPGSAHRHIAAGAVRLDGDWPGLRLDVDTADDLDRAIARGTGAATRSVLHDIGWCGRVHAPVPHVC",
        "proteome": "UP000008190",
        "gene": "fbiD",
        "go_terms": [
            {
                "identifier": "GO:0043814",
                "name": "phospholactate guanylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15d8c4db3b86d47eaae5c57107b4946ad5c82d6c",
        "counters": {
            "domain_architectures": 3805,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3805
        }
    }
}