GET /api/protein/UniProt/H6R5Z9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H6R5Z9",
"id": "H6R5Z9_NOCCG",
"source_organism": {
"taxId": "1127134",
"scientificName": "Nocardia cyriacigeorgica (strain GUH-2)",
"fullName": "Nocardia cyriacigeorgica (strain GUH-2)"
},
"name": "Phosphoenolpyruvate guanylyltransferase",
"description": [
"Guanylyltransferase that catalyzes the activation of phosphoenolpyruvate (PEP) as enolpyruvoyl-2-diphospho-5'-guanosine, via the condensation of PEP with GTP. It is involved in the biosynthesis of coenzyme F420, a hydride carrier cofactor"
],
"length": 231,
"sequence": "MRSHTVHAVIAVKSLDRAKSRLADRLPPRERASLVLAMFTDTVRAATAVAQLASVTVVTPDPAVAERAGRLGALVHPEPMTGPGGPGDPDGLNSALRTAADELRHRHGPVDVLALQADLPALRPDELAGMLATAPRDARSVVVDHAGTGTAALLARAAVPLEPAFGPGSAHRHIAAGAVRLDGDWPGLRLDVDTADDLDRAIARGTGAATRSVLHDIGWCGRVHAPVPHVC",
"proteome": "UP000008190",
"gene": "fbiD",
"go_terms": [
{
"identifier": "GO:0043814",
"name": "phospholactate guanylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15d8c4db3b86d47eaae5c57107b4946ad5c82d6c",
"counters": {
"domain_architectures": 3805,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"hamap": 1,
"pfam": 1,
"ncbifam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3805
}
}
}