General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H6MXD7",
        "id": "H6MXD7_GORPV",
        "source_organism": {
            "taxId": "1112204",
            "scientificName": "Gordonia polyisoprenivorans (strain DSM 44266 / VH2)",
            "fullName": "Gordonia polyisoprenivorans (strain DSM 44266 / VH2)"
        },
        "name": "Methylated-DNA--protein-cysteine methyltransferase",
        "description": [
            "Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction: the enzyme is irreversibly inactivated"
        ],
        "length": 178,
        "sequence": "MGVSTTHETSDVSRRYRSVPTPVDDVLLLAEGEWLIGLYFANHRIPESEWGSLAGDDDPVLSPAVAQLDEYFAGLRQDFDLPLLPRGGALAESIWRLLLDIPYGTTTSYGAIATQLGDRSLAQQVGQAVGRNPIAIIIPCHRVIGADGSLTGFGGGLERKRILLGLEEPSAEDAGRLF",
        "proteome": "UP000009154",
        "gene": "ogt",
        "go_terms": [
            {
                "identifier": "GO:0003908",
                "name": "methylated-DNA-[protein]-cysteine S-methyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ab4da3b1e650a1bbfe332cb0202928b3139c1365",
        "counters": {
            "domain_architectures": 21901,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "ssf": 2,
                "cdd": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21901
        }
    }
}