General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H6MS44",
        "id": "H6MS44_GORPV",
        "source_organism": {
            "taxId": "1112204",
            "scientificName": "Gordonia polyisoprenivorans (strain DSM 44266 / VH2)",
            "fullName": "Gordonia polyisoprenivorans (strain DSM 44266 / VH2)"
        },
        "name": "Phosphate transport system permease protein PstA",
        "description": [
            "Part of the binding-protein-dependent transport system for phosphate; probably responsible for the translocation of the substrate across the membrane"
        ],
        "length": 309,
        "sequence": "MTVTMDKTPGGGPIKASGTAFREVSLSRKLRNNSAKGIFIGCFVIGVIPLVWLLWTVISKGVGAITDPNWWFGDAYGIDTTTQFGAGVAPAIIGSIIQALVAAIISVPIAVLTAVMLVEYPTSRLVKPVSFMVDILAGVPSIVATLFIFTVFVIGLSMGQSGFMVSLALILLMIPIVVRSTEEMLKLVPDELREASYALGIPKWKTIMRIVIPTALSGMLSGIFLAIARIMGETAPVLILAGPASTMVKTNPFEGGMNSLPLFIKDMWAASQPASSFYYWGAALTLIIIVAVLNLFAAVLSKLLAPKTK",
        "proteome": "UP000009154",
        "gene": "pstA",
        "go_terms": [
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005315",
                "name": "phosphate transmembrane transporter activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0035435",
                "name": "phosphate ion transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005886",
                "name": "plasma membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "149ba0064877cb2f3007f9b95b1a3d82ad06c810",
        "counters": {
            "domain_architectures": 894065,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "profile": 1,
                "panther": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 894065
        }
    }
}