GET /api/protein/UniProt/H6MR11/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H6MR11",
        "id": "H6MR11_GORPV",
        "source_organism": {
            "taxId": "1112204",
            "scientificName": "Gordonia polyisoprenivorans (strain DSM 44266 / VH2)",
            "fullName": "Gordonia polyisoprenivorans (strain DSM 44266 / VH2)"
        },
        "name": "Intradiol ring-cleavage dioxygenases domain-containing protein",
        "description": null,
        "length": 183,
        "sequence": "MTALLPPTPAQTIGPFYGYALPFEGDNELVPPRSPGSIRLHGLVTDGHGQPIPDVLLELWQADADGTVVQRAGSLRRDGWTFTGWGRCATDDAGEYSFSTVQPGPIDGAAPYFLITVFGRGLLHRLFTRAYLPGPLAEADPFLAGVPEDRRATLIAAADADGFRFDLRLQGADETVFLHYPGQ",
        "proteome": "UP000009154",
        "gene": "pcaG",
        "go_terms": [
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016702",
                "name": "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008199",
                "name": "ferric iron binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0018578",
                "name": "protocatechuate 3,4-dioxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009056",
                "name": "catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5c2f6294d887b7b8cf1886a74cc5d09ca17e7cf5",
        "counters": {
            "domain_architectures": 15018,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15018
        }
    }
}