General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H6C4P6",
        "id": "H6C4P6_EXODN",
        "source_organism": {
            "taxId": "858893",
            "scientificName": "Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656)",
            "fullName": "Exophiala dermatitidis (strain ATCC 34100 / CBS 525.76 / NIH/UT8656) (Black yeast)"
        },
        "name": "Required for respiratory growth protein 9, mitochondrial",
        "description": [
            "Required for respiratory activity and maintenance and expression of the mitochondrial genome"
        ],
        "length": 301,
        "sequence": "MALNVQTSQRVLWAVVQGSRPPCTSRISRQLHSTARPLIQRPRQSLPGVFVGAQDVHVHKRRRYSSQEPQGAPSHVSETPAVEETTTSRAPGHNAEERPSVTFTKRLGKQRTKRPDKEDAQDSISLGSVRDRNGRSQDQPDAVKSTKAGGGKGKNKRLQLKDLAISKEKEKEPWQIQKQALKEKFGDAGWNPRKKLSPDTMEGIRALHEQDPERWSTPVLADHFKVSPEAIRRILKSRWRPSEKEMEKRRERWARRHDRIWDKMAELGLRPQRTKEKSLEDPDEFEENLKAKEILDNARNA",
        "proteome": "UP000007304",
        "gene": "HMPREF1120_05695",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c1684d32d0ce313f441e89519a70fc50ff0e7048",
        "counters": {
            "domain_architectures": 2333,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2333
        }
    }
}