General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H3AGE4",
        "id": "H3AGE4_LATCH",
        "source_organism": {
            "taxId": "7897",
            "scientificName": "Latimeria chalumnae",
            "fullName": "Latimeria chalumnae (Coelacanth)"
        },
        "name": "Derlin",
        "description": [
            "Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome"
        ],
        "length": 254,
        "sequence": "MSDIGDWFRSIPLLTRYWFAGSILVPLVGKLGLVSPVHLILFPEAFIQKFHIWRPLTATFYFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLFLLIFNWICIVITGLIMNMQLLMIPLIMSVLYIWAQLNRDMIVTFWFGTRFKACYLPWVILGFNYIIGGSIVNELIGNLVGHLYFFLMFKYPMDLGGRSFLTTPQFLYRWLPNRRGGVSGFGVPPTSRRQPADEQDGGGGFGGRHNWGQGFRLGD",
        "proteome": "UP000008672",
        "gene": "DERL1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5e289f64f63688d2c84bfacb1b0e28f6212c66ce",
        "counters": {
            "domain_architectures": 11300,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11300
        }
    }
}