GET /api/protein/UniProt/H2ZVQ2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2ZVQ2",
        "id": "H2ZVQ2_LATCH",
        "source_organism": {
            "taxId": "7897",
            "scientificName": "Latimeria chalumnae",
            "fullName": "Latimeria chalumnae (Coelacanth)"
        },
        "name": "Sulfide:quinone oxidoreductase, mitochondrial",
        "description": [
            "Catalyzes the oxidation of hydrogen sulfide with the help of a quinone, such as ubiquinone-10, giving rise to thiosulfate and ultimately to sulfane (molecular sulfur) atoms. Requires an additional electron acceptor; can use sulfite, sulfide or cyanide (in vitro). It is believed the in vivo electron acceptor is glutathione"
        ],
        "length": 372,
        "sequence": "HYYQPLWTLVGAGAKQLSTSARPTASVIPSGVKWIKSSVKQFYPDENCVYTNDGKKISYKYLIVALGIKLNYDQIKGLPEGFGYPHIGSNYSVETVEKTWKGLQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSDAYLRKTGKRSKANIIFNTSLGVIFAVQKYANALEKIVQERNLHVNYKHNLIEVRADKQEAVFEKLDSAGETVVFEYEMLHVTPPMGPHDVLMKSPLADAGGWVDVDKDTLQHKKYPNVFGIGDCTNLPTSKTAAAVAGQSAVLDKTISMVMKNQTPKTKYDGYTSCPLVTSYNTVILAEFDYNGQPLETFPVNQSKERRTMYYMKSDLMPILYWHGLLKGFWGGPAPVRKLMHLGLKK",
        "proteome": "UP000008672",
        "gene": "SQOR",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}