General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2ZSX2",
        "id": "H2ZSX2_LATCH",
        "source_organism": {
            "taxId": "7897",
            "scientificName": "Latimeria chalumnae",
            "fullName": "Latimeria chalumnae (Coelacanth)"
        },
        "name": "CCN family member 2",
        "description": [
            "Major connective tissue mitoattractant secreted by vascular endothelial cells. Promotes proliferation and differentiation of chondrocytes. Is involved in the stimulation of osteoblast differentiation and has a critical role in osteogenesis. Mediates heparin- and divalent cation-dependent cell adhesion in many cell types including fibroblasts, myofibroblasts, endothelial and epithelial cells. Enhances fibroblast growth factor-induced DNA synthesis"
        ],
        "length": 344,
        "sequence": "MPAGSMKFTFVLLISLFSWACAQDCSGDCRCPEDPPECPLGVSLVMDGCGCCKVCAKQLGELCTEKDICDPHKGLYCDFGSPINRKIGVCTAKEGAPCVFGGMIYRSGESFQSSCKYQCTCLDGGLGCVPLCSMDIRLPSPDCPFPKRVKIPGKCCEEWVCDEPRQRTMVGPALAAYREEATYGPDPTMIRANCLVQTTEWSACSKTCGMGISTRVTNDNRECRLEKQSRLCMVRPCEAVLEENIKKGKKCIRTPKVSSPTKFELSGCTSVKTYRPKFCGVCTDGRCCTPHRTATLSVEFKCPDGEMMKKKMMFIKTCACHYNCPGENDIFQSMYYRKMYGDMA",
        "proteome": "UP000008672",
        "gene": "CCN2",
        "go_terms": [
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007165",
                "name": "signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bf34d72af8f1616b0d6ca73329d2a62e428b8d60",
        "counters": {
            "domain_architectures": 4380,
            "entries": 32,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 4,
                "profile": 4,
                "smart": 4,
                "ssf": 3,
                "cathgene3d": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 3,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4380
        }
    }
}