GET /api/protein/UniProt/H2QP70/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2QP70",
        "id": "H2QP70_PANTR",
        "source_organism": {
            "taxId": "9598",
            "scientificName": "Pan troglodytes",
            "fullName": "Pan troglodytes (Chimpanzee)"
        },
        "name": "GrpE protein homolog",
        "description": [
            "Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins"
        ],
        "length": 217,
        "sequence": "MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA",
        "proteome": "UP000002277",
        "gene": "GRPEL1",
        "go_terms": [
            {
                "identifier": "GO:0000774",
                "name": "adenyl-nucleotide exchange factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042803",
                "name": "protein homodimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051087",
                "name": "protein-folding chaperone binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006457",
                "name": "protein folding",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bcfacd3ac840c2030716357b736a826603778042",
        "counters": {
            "domain_architectures": 36652,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 36652
        }
    }
}