HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H2Q253",
"id": "H2Q253_PANTR",
"source_organism": {
"taxId": "9598",
"scientificName": "Pan troglodytes",
"fullName": "Pan troglodytes (Chimpanzee)"
},
"name": "Peptidyl-prolyl cis-trans isomerase",
"description": [
"PPIase that catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and may therefore assist protein folding. Involved in regulation of the mitochondrial permeability transition pore (mPTP). It is proposed that its association with the mPTP is masking a binding site for inhibiting inorganic phosphate (Pi) and promotes the open probability of the mPTP leading to apoptosis or necrosis; the requirement of the PPIase activity for this function is debated. In cooperation with mitochondrial p53/TP53 is involved in activating oxidative stress-induced necrosis. Involved in modulation of mitochondrial membrane F(1)F(0) ATP synthase activity and regulation of mitochondrial matrix adenine nucleotide levels. Has anti-apoptotic activity independently of mPTP and in cooperation with BCL2 inhibits cytochrome c-dependent apoptosis",
"PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides"
],
"length": 207,
"sequence": "MLALRCGSRWLGLLSVPRSVPLRLPAARACSKGAGDPSSSSSSGNPLVYLDVDANGKPLGRVVLELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKKIESFGSKSGRTSKKIVITDCGQLS",
"proteome": "UP000002277",
"gene": "PPIF",
"go_terms": [
{
"identifier": "GO:0003755",
"name": "peptidyl-prolyl cis-trans isomerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000413",
"name": "protein peptidyl-prolyl isomerization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006457",
"name": "protein folding",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ec13550bd3f45711d77ed9b599f14cde4aa876a9",
"counters": {
"domain_architectures": 108117,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"profile": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 108117
}
}
}