GET /api/protein/UniProt/H2PJR7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H2PJR7",
"id": "H2PJR7_PONAB",
"source_organism": {
"taxId": "9601",
"scientificName": "Pongo abelii",
"fullName": "Pongo abelii (Sumatran orangutan)"
},
"name": "Glycoprotein hormones alpha chain",
"description": [
"Shared alpha chain of the active heterodimeric glycoprotein hormones thyrotropin/thyroid stimulating hormone/TSH, lutropin/luteinizing hormone/LH, follitropin/follicle stimulating hormone/FSH and choriogonadotropin/CG. These hormones bind specific receptors on target cells that in turn activate downstream signaling pathways"
],
"length": 116,
"sequence": "MDYYRKYAAAFLVILSVFLHVLHSAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGNFKVENHTACHCSTCYFHKS",
"proteome": "UP000001595",
"gene": "CGA",
"go_terms": [
{
"identifier": "GO:0005179",
"name": "hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c41de36a481f7d27550f55756c70e925da8ec8a1",
"counters": {
"domain_architectures": 1246,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"prints": 1,
"prosite": 2,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1246
}
}
}