GET /api/protein/UniProt/H2NX83/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2NX83",
        "id": "H2NX83_PONAB",
        "source_organism": {
            "taxId": "9601",
            "scientificName": "Pongo abelii",
            "fullName": "Pongo abelii (Sumatran orangutan)"
        },
        "name": "Mitochondrial adenyl nucleotide antiporter SLC25A23",
        "description": [
            "Electroneutral antiporter that mediates the transport of adenine nucleotides through the inner mitochondrial membrane. Originally identified as an ATP-magnesium/inorganic phosphate antiporter, it also acts as a broad specificity adenyl nucleotide antiporter. By regulating the mitochondrial matrix adenine nucleotide pool could adapt to changing cellular energetic demands and indirectly regulate adenine nucleotide-dependent metabolic pathways. Also acts as a regulator of mitochondrial calcium uptake and can probably transport trace amounts of other divalent metal cations in complex with ATP. In vitro, a low activity is also observed with guanyl and pyrimidine nucleotides"
        ],
        "length": 438,
        "sequence": "MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTVLDIGECLTVPDEFSKQEKLTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHASKTNRLNILGGLRSMVLEGGVRSLWRGNGINVLKIAPESAIKFMAYEQIKRAILGQQETLHVQERFVAGSLAGATAQTIIYPMEVLKTRLTLRRTGQYKGLLDCARRILEREGPRAFYRGYLPNVLGIIPYAGIDLAVYETLKNWWLQQYSHDSADPGILVLLACGTISSTCGQIASYPLALVRTRMQAQDTSVYKTDTVPTLIELTGWRGRKMLNKSFWN",
        "proteome": "UP000001595",
        "gene": "SLC25A23",
        "go_terms": [
            {
                "identifier": "GO:0005509",
                "name": "calcium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0055085",
                "name": "transmembrane transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "70f879a8b3542c2ee14c96daedb06a8cc75e3ef3",
        "counters": {
            "domain_architectures": 4406,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "profile": 2,
                "pfam": 2,
                "smart": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4406
        }
    }
}