GET /api/protein/UniProt/H2NKE6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H2NKE6",
        "id": "H2NKE6_PONAB",
        "source_organism": {
            "taxId": "9601",
            "scientificName": "Pongo abelii",
            "fullName": "Pongo abelii (Sumatran orangutan)"
        },
        "name": "G protein-coupled receptor kinase",
        "description": [
            "Retina-specific kinase involved in the signal turnoff via phosphorylation of rhodopsin (RHO), the G protein- coupled receptor that initiates the phototransduction cascade. This rapid desensitization is essential for scotopic vision and permits rapid adaptation to changes in illumination. May play a role in the maintenance of the outer nuclear layer in the retina"
        ],
        "length": 563,
        "sequence": "MDFGSLETVVANSAFIAARGSFDSGSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHVPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGTVAKFKEGPVEIQDGLFQPLLQATLAHLGQAPFQEYLGSLYFLRFLQWKWLEAQPMGEDWFLDFRVLGKGGFGEVSACQMKATGKLYACKKLNKKRLKKRKGYQGAMVEKKILMKVHSRFIVSLAYAFETKADLCLVMTIMNGGDIRYHIYNVNEENPGFPEPRAVFYTAQIICGLEHLHQRRIVYRDLKPENVLLDNDGNVRISDLGLAVELLDGQSKTKGYAGTPGFMAPELLQGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKHRIISEPVKYPDKFSQASKDFCEALLEKDPEKRLGFRDETCDKLRAHPLFKDLNWRQLEAGMLMPPFIPDSKTVYAKDIQDVGAFSTVKGVAFDKTDTEFCQEFATGNCPIPWQEEMIETGIFGELNVWRSDGQMPDDMKGISGGSGSSSKSGMCLVS",
        "proteome": "UP000001595",
        "gene": "GRK1",
        "go_terms": [
            {
                "identifier": "GO:0050254",
                "name": "rhodopsin kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007601",
                "name": "visual perception",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0022400",
                "name": "regulation of opsin-mediated signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004672",
                "name": "protein kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006468",
                "name": "protein phosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004674",
                "name": "protein serine/threonine kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004703",
                "name": "G protein-coupled receptor kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007165",
                "name": "signal transduction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2ee68e726ca7e7e708bd2aa9646705deedf1d08d",
        "counters": {
            "domain_architectures": 6985,
            "entries": 28,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 2,
                "smart": 3,
                "pfam": 2,
                "profile": 3,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 10
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 6985
        }
    }
}