HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H2EQR2",
"id": "H2EQR2_9GENT",
"source_organism": {
"taxId": "232092",
"scientificName": "Coffea arabica x Coffea canephora",
"fullName": "Coffea arabica x Coffea canephora"
},
"name": "Plant heme peroxidase family profile domain-containing protein",
"description": null,
"length": 251,
"sequence": "AWHDAGTYDVNTKTGGPNGSIRNEEEYSHSANSGLRIALNFCEEVRSRHPKITYADLYQLAGVVAVEVTGGPTIDFVAGRKDSMISPKEGRLPDANKGVPHLRDVFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTKEPLKFDNSYFVELLKGESDGLLKLPTDIALLEDPEFRRLVELYAKDEDAFFRDYAVSHKKLSELGFTPHSSGSKATVKDSTILVQSAVGVAVAAAVVVLSYLYEVRKKIK",
"proteome": null,
"gene": "mAPX",
"go_terms": [
{
"identifier": "GO:0004601",
"name": "peroxidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0020037",
"name": "heme binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006979",
"name": "response to oxidative stress",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0034599",
"name": "cellular response to oxidative stress",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "14f0affbad7d6f2240b4fb0cbb503bfe9b0e92c5",
"counters": {
"domain_architectures": 59418,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 2,
"cdd": 1,
"ssf": 1,
"profile": 1,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 59418
}
}
}