GET /api/protein/UniProt/H1W589/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H1W589",
"id": "H1W589_COLHI",
"source_organism": {
"taxId": "759273",
"scientificName": "Colletotrichum higginsianum (strain IMI 349063)",
"fullName": "Colletotrichum higginsianum (strain IMI 349063) (Crucifer anthracnose fungus)"
},
"name": "Mitochondrial thiamine pyrophosphate carrier 1",
"description": [
"Mitochondrial transporter that mediates uptake of thiamine pyrophosphate (ThPP) into mitochondria"
],
"length": 375,
"sequence": "MSEIAPNKQRDAARPKPPPRAPPVCPTDDDETIETRKQTRTFDYIWRSGVAGGLAGCAAKTVVAPLDRVKILFQASNPQFAKYTGSWFGVVTAMKDIRSHEGLTGLFRGHSATLIRIFPYAGIKFLAYEQIRSMVIRRKEHETPWRRLISGSMAGVTSVFFTYPLEVIRVRLAFETKHGGSSLAAICRRIYNERFVRTSPAAQAASTSATEAAAASPVAAIAPRSGLINFYRGFTPTLLGMLPYAGMSFLTHDTAGDILRHPSLAKWTTLPQQKNSPTGKPAPLRSWAELLAGGVAGLVSQTASYPLEVIRRRMQVGGAVGDGHRLRISETAAMIFREKGTPGFFVGLTIGYVKVVPMAAVAFYTYERAKTWLRI",
"proteome": null,
"gene": "CH063_04230",
"go_terms": [
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d827d20670d7ef4a84fc3787abac7bdc4f466d09",
"counters": {
"domain_architectures": 7309,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"prints": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 7309
}
}
}