GET /api/protein/UniProt/H1V9I8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H1V9I8",
"id": "H1V9I8_COLHI",
"source_organism": {
"taxId": "759273",
"scientificName": "Colletotrichum higginsianum (strain IMI 349063)",
"fullName": "Colletotrichum higginsianum (strain IMI 349063) (Crucifer anthracnose fungus)"
},
"name": "very-long-chain enoyl-CoA reductase",
"description": [
"Catalyzes the last of the four reactions of the long-chain fatty acids elongation cycle. This endoplasmic reticulum-bound enzymatic process, allows the addition of 2 carbons to the chain of long- and very long-chain fatty acids/VLCFAs per cycle. This enzyme reduces the trans-2,3-enoyl-CoA fatty acid intermediate to an acyl-CoA that can be further elongated by entering a new cycle of elongation. Thereby, it participates in the production of VLCFAs of different chain lengths that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators"
],
"length": 310,
"sequence": "MAAKITLKLSNRSPKQPIKKLPETIEVPADATVEEVKHIVARKAGFSDFNRVGLFDPSTQKTLKNRKAQISSEPAVMSAGHVLVKDLGPQLAWSTVFVIEYLGPILIHLAVVSLRPYIYSGPGATKALSPTQLLTLAMFLGHFLKREYETLFVHKFSANTMPLRNIFKNSFFYWAFAGLLSAWHVYSPSSPTALARNDAVDVLGTIIFLFGEASNAIVHLNLASLRSHGGTERQIPRGYGFSLVTCPNYMFEIISWIGVIITSRSWAVAVFIAIGAAQMAQWAKGKERAYRKEFPETYKKKKFVLLPGIF",
"proteome": "UP000092177",
"gene": "CH063_01590",
"go_terms": [
{
"identifier": "GO:0016627",
"name": "oxidoreductase activity, acting on the CH-CH group of donors",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006629",
"name": "lipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "249a07fa23f546641bf50c576f6f83b8fb8dadf3",
"counters": {
"domain_architectures": 12867,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"profile": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12867
}
}
}