General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H1PNP3",
        "id": "H1PNP3_9FUSO",
        "source_organism": {
            "taxId": "457404",
            "scientificName": "Fusobacterium ulcerans 12-1B",
            "fullName": "Fusobacterium ulcerans 12-1B"
        },
        "name": "Ribokinase",
        "description": [
            "Catalyzes the phosphorylation of ribose at O-5 in a reaction requiring ATP and magnesium. The resulting D-ribose-5-phosphate can then be used either for sythesis of nucleotides, histidine, and tryptophan, or as a component of the pentose phosphate pathway"
        ],
        "length": 307,
        "sequence": "MKKVVVAGSINMDLVTICERAPKGGETLFGKEFFQVPGGKGANQAVAIGKLGTQVTMLGKIGNDSFGKDLISSMNNSGVDTKYIETSASSTGIAKIIVEENGQNRILVVSGANMDVDRAYIDRHMDIINEADILVTQLEIPMDTVEYALKKAKEAGKTTILNPAPAAPLNDEIIRNSDIIIPNESELGIITGMPTNTLEEIEAAARKLLNMGVKELIVTLGSQGSLHLNKKGSVMHTAYKVKAVDTTAAGDSFIGGLVRNIQADNLDEAIEFATKVSAITVTRKGAQISIPTIEEVENFKGEKNEKK",
        "proteome": "UP000003233",
        "gene": "rbsK",
        "go_terms": [
            {
                "identifier": "GO:0004747",
                "name": "ribokinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006014",
                "name": "D-ribose metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016773",
                "name": "phosphotransferase activity, alcohol group as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016301",
                "name": "kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15af1988c305a97f244d41de7ad5bb09a2fb2e9e",
        "counters": {
            "domain_architectures": 158989,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "pirsf": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 158989
        }
    }
}