HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H1PNP3",
"id": "H1PNP3_9FUSO",
"source_organism": {
"taxId": "457404",
"scientificName": "Fusobacterium ulcerans 12-1B",
"fullName": "Fusobacterium ulcerans 12-1B"
},
"name": "Ribokinase",
"description": [
"Catalyzes the phosphorylation of ribose at O-5 in a reaction requiring ATP and magnesium. The resulting D-ribose-5-phosphate can then be used either for sythesis of nucleotides, histidine, and tryptophan, or as a component of the pentose phosphate pathway"
],
"length": 307,
"sequence": "MKKVVVAGSINMDLVTICERAPKGGETLFGKEFFQVPGGKGANQAVAIGKLGTQVTMLGKIGNDSFGKDLISSMNNSGVDTKYIETSASSTGIAKIIVEENGQNRILVVSGANMDVDRAYIDRHMDIINEADILVTQLEIPMDTVEYALKKAKEAGKTTILNPAPAAPLNDEIIRNSDIIIPNESELGIITGMPTNTLEEIEAAARKLLNMGVKELIVTLGSQGSLHLNKKGSVMHTAYKVKAVDTTAAGDSFIGGLVRNIQADNLDEAIEFATKVSAITVTRKGAQISIPTIEEVENFKGEKNEKK",
"proteome": "UP000003233",
"gene": "rbsK",
"go_terms": [
{
"identifier": "GO:0004747",
"name": "ribokinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006014",
"name": "D-ribose metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016773",
"name": "phosphotransferase activity, alcohol group as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016301",
"name": "kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15af1988c305a97f244d41de7ad5bb09a2fb2e9e",
"counters": {
"domain_architectures": 158989,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"pirsf": 1,
"prosite": 2,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 158989
}
}
}