HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H0XDZ5",
"id": "H0XDZ5_OTOGA",
"source_organism": {
"taxId": "30611",
"scientificName": "Otolemur garnettii",
"fullName": "Otolemur garnettii (Small-eared galago)"
},
"name": "Cathepsin B",
"description": [
"Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Cleaves matrix extracellular phosphoglycoprotein MEPE. Involved in the solubilization of cross-linked TG/thyroglobulin in the thyroid follicle lumen. Has also been implicated in tumor invasion and metastasis"
],
"length": 339,
"sequence": "MWRLLASLCCLLVLTSAWSKPYFHPLSDELVNFINKQNSTWQAGHNFRNVDMSYLKRLCGSFLGGPKLPQRVKFAKDMNLPKSFDAREQWSHCPTIKEIRDQGSCGSCWAFGAVESISDRICIHTNGHVSVEVSAEDLLTCCGGQCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPACTGEGDTPKCSKTCEPGYSPTYKEDKHFGYTSYSLPTNEWEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHLTGDMMGGHAIRILGWGEENGVPYWLVANSWNTDWGDGGFFRILRGQDHCGIESEVVAGIPRTDQYWEKI",
"proteome": "UP000005225",
"gene": "CTSB",
"go_terms": [
{
"identifier": "GO:0004197",
"name": "cysteine-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050790",
"name": "regulation of catalytic activity",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008234",
"name": "cysteine-type peptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f09cbe7b3e5ea5c31f0ef1db4dc59ab56f5d6f2e",
"counters": {
"domain_architectures": 3274,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"smart": 1,
"cdd": 1,
"panther": 1,
"prosite": 3,
"prints": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3274
}
}
}