GET /api/protein/UniProt/H0XDZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H0XDZ5",
        "id": "H0XDZ5_OTOGA",
        "source_organism": {
            "taxId": "30611",
            "scientificName": "Otolemur garnettii",
            "fullName": "Otolemur garnettii (Small-eared galago)"
        },
        "name": "Cathepsin B",
        "description": [
            "Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Cleaves matrix extracellular phosphoglycoprotein MEPE. Involved in the solubilization of cross-linked TG/thyroglobulin in the thyroid follicle lumen. Has also been implicated in tumor invasion and metastasis"
        ],
        "length": 339,
        "sequence": "MWRLLASLCCLLVLTSAWSKPYFHPLSDELVNFINKQNSTWQAGHNFRNVDMSYLKRLCGSFLGGPKLPQRVKFAKDMNLPKSFDAREQWSHCPTIKEIRDQGSCGSCWAFGAVESISDRICIHTNGHVSVEVSAEDLLTCCGGQCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPACTGEGDTPKCSKTCEPGYSPTYKEDKHFGYTSYSLPTNEWEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHLTGDMMGGHAIRILGWGEENGVPYWLVANSWNTDWGDGGFFRILRGQDHCGIESEVVAGIPRTDQYWEKI",
        "proteome": "UP000005225",
        "gene": "CTSB",
        "go_terms": [
            {
                "identifier": "GO:0004197",
                "name": "cysteine-type endopeptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050790",
                "name": "regulation of catalytic activity",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008234",
                "name": "cysteine-type peptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006508",
                "name": "proteolysis",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f09cbe7b3e5ea5c31f0ef1db4dc59ab56f5d6f2e",
        "counters": {
            "domain_architectures": 3274,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "smart": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 3,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3274
        }
    }
}