General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H0XBS7",
        "id": "H0XBS7_OTOGA",
        "source_organism": {
            "taxId": "30611",
            "scientificName": "Otolemur garnettii",
            "fullName": "Otolemur garnettii (Small-eared galago)"
        },
        "name": "tRNA-specific adenosine deaminase 2",
        "description": [
            "Probably participates in deamination of adenosine-34 to inosine in many tRNAs"
        ],
        "length": 191,
        "sequence": "MEGKATSTPSTDRACSVSAEEIEKWMEAAMHMAKEALANTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGRSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRLFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS",
        "proteome": "UP000005225",
        "gene": "ADAT2",
        "go_terms": [
            {
                "identifier": "GO:0008251",
                "name": "tRNA-specific adenosine deaminase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0002100",
                "name": "tRNA wobble adenosine to inosine editing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008270",
                "name": "zinc ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016787",
                "name": "hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f99539802ad74cdae12e721eaf57a43643662eeb",
        "counters": {
            "domain_architectures": 85233,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "cdd": 1,
                "panther": 1,
                "hamap": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 85233
        }
    }
}