HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H0XBS7",
"id": "H0XBS7_OTOGA",
"source_organism": {
"taxId": "30611",
"scientificName": "Otolemur garnettii",
"fullName": "Otolemur garnettii (Small-eared galago)"
},
"name": "tRNA-specific adenosine deaminase 2",
"description": [
"Probably participates in deamination of adenosine-34 to inosine in many tRNAs"
],
"length": 191,
"sequence": "MEGKATSTPSTDRACSVSAEEIEKWMEAAMHMAKEALANTEVPVGCLMVYNNEVVGKGRNEVNQTKNATRHAEMVAIDQVLDWCRQSGRSPSEVFEHTVLYVTVEPCIMCAAALRLMKIPLVVYGCQNERFGGCGSVLNIASADLPNTGRLFQCIPGYRAEEAVEMLKTFYKQENPNAPKSKVRKKECQKS",
"proteome": "UP000005225",
"gene": "ADAT2",
"go_terms": [
{
"identifier": "GO:0008251",
"name": "tRNA-specific adenosine deaminase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0002100",
"name": "tRNA wobble adenosine to inosine editing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f99539802ad74cdae12e721eaf57a43643662eeb",
"counters": {
"domain_architectures": 85233,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"hamap": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 85233
}
}
}