HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H0WQU5",
"id": "H0WQU5_OTOGA",
"source_organism": {
"taxId": "30611",
"scientificName": "Otolemur garnettii",
"fullName": "Otolemur garnettii (Small-eared galago)"
},
"name": "Thioredoxin reductase 3",
"description": [
"Displays thioredoxin reductase, glutaredoxin and glutathione reductase activities. Catalyzes disulfide bond isomerization. Promotes disulfide bond formation between GPX4 and various sperm proteins and may play a role in sperm maturation by promoting formation of sperm structural components"
],
"length": 595,
"sequence": "RPPEDREEVRRRLMGLIEGNRVMIFSKSYCPYSTRVKELFSSLGIGCNILELDQIDDGANVQEVLSEISNQKTVPNIFVNKVHVGGCDRTFQAHQNGLLQKLLQEDSAYDYDLIVIGGGSGGLACAKEAAILGKKVMVLDFVVPSPQGTSWGLGGTCVNVGCIPKKLMHQAALLGQALHDSRKFGWEYNQHVRHSWETMIEAVQNHIGSLNWGYRLSLREKSVAYVNSYGEFVEHHKIKATNRKGQETCYTAAKFVIATGERPRYLGIQGDKEYCITSDDLFSLPHCPGKTLVVGASYVALECAGFLAGLGLEVTVMVRSVLLRGFDQEMAEKVGSYMEQHGVKFLRKFVPVMVQQLEKGSPGKLKVSAKSTEGPETIEGIYNTLLIFVISDPCTRKIGLEKIGVKINEKNGKIPVNDVEQTNVPYVFAIGDVLEGKPELTPVAIQAGKLLARRLFGAASEKCDYVNIPTAVFTPLEYGCCGLSEEKAVEAYKKENLEVFHSFFWPLEWTLAGRDNNTCYAKIICNKLDHDRIIGLHILGPNAGEVTQGFAAAMKCGLTKQQLDDTIGIHPTCGEVFTALEITKSSGLDITQKGC",
"proteome": "UP000005225",
"gene": null,
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050660",
"name": "flavin adenine dinucleotide binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045454",
"name": "cell redox homeostasis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004791",
"name": "thioredoxin-disulfide reductase (NADPH) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016668",
"name": "oxidoreductase activity, acting on a sulfur group of donors, NAD(P) as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c6e7786c4de746e322561b18292160cad8bf5ee7",
"counters": {
"domain_architectures": 1152,
"entries": 27,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"profile": 1,
"ssf": 3,
"cdd": 1,
"pfam": 3,
"ncbifam": 2,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1152
}
}
}