General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H0WJR2",
        "id": "H0WJR2_OTOGA",
        "source_organism": {
            "taxId": "30611",
            "scientificName": "Otolemur garnettii",
            "fullName": "Otolemur garnettii (Small-eared galago)"
        },
        "name": "MICOS complex subunit",
        "description": [
            "Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane"
        ],
        "length": 198,
        "sequence": "VFQVLQRSVGPASLSLLAFKVYAAPRKDSPPTNPMKVNELSLYSVPEGQSKYVEEPRTQLEETISQLRNHCEPYTSWCQETYSQTKPKMQSLVQLGLDSYEYLQHAPPGFFPRLGVIGFAGLVGLLLARGSKVKKLVYPPGFMGLAASIYYPQQAIAFVQVGGEKLYDWGLRGYIVVEDLWKRNFQKPGSVKNSPGNK",
        "proteome": "UP000005225",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0042407",
                "name": "cristae formation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0061617",
                "name": "MICOS complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d042619ba39886ae04423eab27510f77b2e65e56",
        "counters": {
            "domain_architectures": 4991,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4991
        }
    }
}