GET /api/protein/UniProt/H0W631/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H0W631",
"id": "H0W631_CAVPO",
"source_organism": {
"taxId": "10141",
"scientificName": "Cavia porcellus",
"fullName": "Cavia porcellus (Guinea pig)"
},
"name": "Sulfotransferase",
"description": [
"Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Catalyzes with a lower efficiency the sulfation of Gal residues of keratan sulfate, another glycosaminoglycan. Can also catalyze the sulfation of the Gal residues in sialyl N-acetyllactosamine (sialyl LacNAc) oligosaccharides. May play a role in the maintenance of naive T-lymphocytes in the spleen"
],
"length": 473,
"sequence": "MEKGLAVAQDCWDFAHSLRMRSKYALFLAFVVIVFIFIEKENKIISRVSHRLKQIPQSLADANGTDPALILAENASLLSLSELDSAFSQLQSRLHNLSLQLGVEPASKEAPVAAEPSQPASAPRQQRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVAFEQRGSSAAGSALVYRDVLQQLFLCDLYVLEPFISPVPEAHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKDRRCGPLNVTLAAEACRRKDHMALKAVRIRQLEFLKPLAEDPRLDLRVIQLVRDPRAVLASRIVAFAGKYETWKKWLAEGQDQLQEEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARSPLQKAREMYRFAGIPLTPQVEEWIQKNTQAALDSSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACASTMRLFGYKLAKDAASLTNRSISLLEERGTFWVT",
"proteome": "UP000005447",
"gene": "CHST3",
"go_terms": [
{
"identifier": "GO:0008146",
"name": "sulfotransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0000139",
"name": "Golgi membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c3f904adb28054815298b5a4924ad2c008edc08c",
"counters": {
"domain_architectures": 55737,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"pirsf": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 55737
}
}
}