GET /api/protein/UniProt/H0W631/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "H0W631",
        "id": "H0W631_CAVPO",
        "source_organism": {
            "taxId": "10141",
            "scientificName": "Cavia porcellus",
            "fullName": "Cavia porcellus (Guinea pig)"
        },
        "name": "Sulfotransferase",
        "description": [
            "Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the transfer of sulfate to position 6 of the N-acetylgalactosamine (GalNAc) residue of chondroitin. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Catalyzes with a lower efficiency the sulfation of Gal residues of keratan sulfate, another glycosaminoglycan. Can also catalyze the sulfation of the Gal residues in sialyl N-acetyllactosamine (sialyl LacNAc) oligosaccharides. May play a role in the maintenance of naive T-lymphocytes in the spleen"
        ],
        "length": 473,
        "sequence": "MEKGLAVAQDCWDFAHSLRMRSKYALFLAFVVIVFIFIEKENKIISRVSHRLKQIPQSLADANGTDPALILAENASLLSLSELDSAFSQLQSRLHNLSLQLGVEPASKEAPVAAEPSQPASAPRQQRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVAFEQRGSSAAGSALVYRDVLQQLFLCDLYVLEPFISPVPEAHLTQFMFRRGSSRSLCEDPVCTPFVKKVFEKYHCKDRRCGPLNVTLAAEACRRKDHMALKAVRIRQLEFLKPLAEDPRLDLRVIQLVRDPRAVLASRIVAFAGKYETWKKWLAEGQDQLQEEEVQRLRGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARSPLQKAREMYRFAGIPLTPQVEEWIQKNTQAALDSSGIYSTQKNSSEQFEKWRFSMPFKLAQVVQAACASTMRLFGYKLAKDAASLTNRSISLLEERGTFWVT",
        "proteome": "UP000005447",
        "gene": "CHST3",
        "go_terms": [
            {
                "identifier": "GO:0008146",
                "name": "sulfotransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000139",
                "name": "Golgi membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c3f904adb28054815298b5a4924ad2c008edc08c",
        "counters": {
            "domain_architectures": 55737,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 55737
        }
    }
}