GET /api/protein/UniProt/H0VEX6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "H0VEX6",
"id": "H0VEX6_CAVPO",
"source_organism": {
"taxId": "10141",
"scientificName": "Cavia porcellus",
"fullName": "Cavia porcellus (Guinea pig)"
},
"name": "GTPase Era, mitochondrial",
"description": [
"Probable GTPase that plays a role in the mitochondrial ribosomal small subunit assembly. Specifically binds the 12S mitochondrial rRNA (12S mt-rRNA) to a 33 nucleotide section delineating the 3' terminal stem-loop region. May act as a chaperone that protects the 12S mt-rRNA on the 28S mitoribosomal subunit during ribosomal small subunit assembly"
],
"length": 437,
"sequence": "MAAPRRYGCGLVRFLLGAWQLGPYAAREQEAPLRLLVGCQKRFLSCLVGSAFSGPRLALASRSYGQGSALDRFLGFSQVDSSPTSVVPAVSMNRDEQDLLLDCPPDMPENPRVLRVVFLGAPNAGKSTLSNQLLGRQVFPVSKKVHTTRCQALGVITEKETQLILLDTPGIISSAKQKRHHLELSLLEDPWKSMESANLVVVLVDVSDKWTRNQLSPQVLQCLTQFSQVPSILVLNKVDCLKQKAVLLELTAALTEGVVNGKKLNMRQAFRSHSDNHCSSPAAKDPNTQSVRNPQRIGWPHFQEIFMLSSLSQEDVKTLKHYLLAQAQPGPWEFHSGVLTNQTPEEICTNKIREKLLEHLPQEVPYNVQQKTVVWEEGPSGELLIQQNLLVPKESHVRILIGQKGQLIAQIAQEVGRDLMDIFLCDVHIRLAVKLLK",
"proteome": "UP000005447",
"gene": "ERAL1",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d07fe611ffd6d32e179a8705eda9bff6c793fd7f",
"counters": {
"domain_architectures": 25645,
"entries": 21,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 2,
"ssf": 2,
"profile": 2,
"ncbifam": 1,
"pfam": 2,
"panther": 1,
"prints": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25645
}
}
}