GET /api/protein/UniProt/G9MR33/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G9MR33",
        "id": "G9MR33_HYPVG",
        "source_organism": {
            "taxId": "413071",
            "scientificName": "Hypocrea virens (strain Gv29-8 / FGSC 10586)",
            "fullName": "Hypocrea virens (strain Gv29-8 / FGSC 10586) (Gliocladium virens)"
        },
        "name": "4-hydroxy-3-methoxy-5-polyprenylbenzoate decarboxylase",
        "description": [
            "Lyase that catalyzes the C1-decarboxylation of 4-hydroxy-3-methoxy-5-(all-trans-polyprenyl)benzoic acid into 2-methoxy-6-(all-trans-polyprenyl)phenol during ubiquinone biosynthesis"
        ],
        "length": 259,
        "sequence": "MARSFSALNRPPPKYPGHVPLTRIEQAGMALGSGIMSLLNPYRADLIATLGEATATPYFIYRLRDAMLAHPTGRRILRLRPRISSKTLSIPALRALPENSVGRAYVSWLDREGVSPDTRSPVRYIDDEECAYVMQRYRECHDFYHALTGLPTVREGEVALKAFEFANTLIPMTGLSMLAVATLKPAERRRFFSVYMPWAVKNGVRSKEIINVFWEEELERDVEDLRRELGIEQPPDLREIRKREKEEKKRLKEMRAQGF",
        "proteome": "UP000007115",
        "gene": "COQ4",
        "go_terms": [
            {
                "identifier": "GO:0006744",
                "name": "ubiquinone biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005743",
                "name": "mitochondrial inner membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "42b4bae8af913e69bce4749e4c6b913655bf4e4c",
        "counters": {
            "domain_architectures": 5672,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "hamap": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5672
        }
    }
}