GET /api/protein/UniProt/G9IME6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G9IME6",
"id": "G9IME6_BRAJP",
"source_organism": {
"taxId": "1079467",
"scientificName": "Bradyrhizobium japonicum USDA 38",
"fullName": "Bradyrhizobium japonicum USDA 38"
},
"name": "Glyceraldehyde 3-phosphate dehydrogenase catalytic domain-containing protein",
"description": null,
"length": 148,
"sequence": "VLNDLVGIETGFMTTIHAYTGDQPTLDTMHKDLYRGRAAAMSMIPTSTGAAKAIGLVLPELKGKLDGVAIRVPTPNVSVVDLKIIAKRATDAKEINAAMKRASEQQLKGILGYTTAPNVSIDFNHDPHSSTFHEDQTKVQNGTLVRVM",
"proteome": null,
"gene": "gap",
"go_terms": [
{
"identifier": "GO:0016620",
"name": "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7a78f3561b6209e9a262d9b646b8f6532a476784",
"counters": {
"domain_architectures": 17529,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"prints": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 17529
}
}
}