HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G9HXW0",
"id": "G9HXW0_9ORYZ",
"source_organism": {
"taxId": "196901",
"scientificName": "Leersia tisserantii",
"fullName": "Leersia tisserantii"
},
"name": "Photosystem I iron-sulfur center",
"description": [
"Apoprotein for the two 4Fe-4S centers FA and FB of photosystem I (PSI); essential for photochemical activity. FB is the terminal electron acceptor of PSI, donating electrons to ferredoxin. The C-terminus interacts with PsaA/B/D and helps assemble the protein into the PSI complex. Required for binding of PsaD and PsaE to PSI. PSI is a plastocyanin-ferredoxin oxidoreductase, converting photonic excitation into a charge separation, which transfers an electron from the donor P700 chlorophyll pair to the spectroscopically characterized acceptors A0, A1, FX, FA and FB in turn"
],
"length": 81,
"sequence": "MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRTEDCVGCKRCESACPTDFLSVRVYLGPETTRSMALSY",
"proteome": null,
"gene": "psaC",
"go_terms": [
{
"identifier": "GO:0009055",
"name": "electron transfer activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009773",
"name": "photosynthetic electron transport in photosystem I",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0015979",
"name": "photosynthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009522",
"name": "photosystem I",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0042651",
"name": "thylakoid membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6c07d9494256355cee46d63af45f6573fe21c2b0",
"counters": {
"domain_architectures": 45829,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 45829
}
}
}