HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G8ZTV4",
"id": "G8ZTV4_TORDE",
"source_organism": {
"taxId": "4950",
"scientificName": "Torulaspora delbrueckii",
"fullName": "Torulaspora delbrueckii (Yeast)"
},
"name": "tRNA-5-taurinomethyluridine 2-sulfurtransferase",
"description": [
"Catalyzes the 2-thiolation of uridine at the wobble position (U34) of mitochondrial tRNA(Lys), tRNA(Glu) and tRNA(Gln). Required for the formation of 5-taurinomethyl-2-thiouridine (tm5s2U) of mitochondrial tRNA(Lys), tRNA(Glu), and tRNA(Gln) at the wobble position. ATP is required to activate the C2 atom of the wobble base"
],
"length": 409,
"sequence": "MLARWAKLVSDRQLLKYRPQRLPGKLDNVIIAMSSGVDSSVAAALFAGEYPNARGIYMQNWSKSQSLTDPKDDPCYERDWKDVVKVSEHLNLPVEKVNFEQDYWIDVFEPMLEGYNKGWTPNPDISCNKFVKFGKLIQHLNSKYGNDNYWLVTGHYARIMESELDKEAHLLRSFYPQKDQSYYLSLVDPKILSRLLFPIGHLTKPEVRQLAKEIALPSANKPDSQGICFVNNSQHGKFKNFLEHYLVESKGDIVTLDQGKKRKWGEHKGLWSYTIGQKIGLSMPQGDPKYAGTWYVSEKLQDSNELVIVHGSNNPALYKDTLQVQDFTIQGNKKSLLKSLMHSAVLEGRLTMQYRSLQEPIPITAFDLSDKKVLNLKLTAKQRAMAPGQNCCLYIGDRVLGSGTIREVA",
"proteome": "UP000005627",
"gene": "TDEL0D04640",
"go_terms": [
{
"identifier": "GO:0016740",
"name": "transferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008033",
"name": "tRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016783",
"name": "sulfurtransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "eea6bd6f05413ed5899e6ed945f81f92c19b1a59",
"counters": {
"domain_architectures": 28892,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 1,
"pfam": 3,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 28892
}
}
}