General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G8ZQF3",
        "id": "G8ZQF3_TORDE",
        "source_organism": {
            "taxId": "4950",
            "scientificName": "Torulaspora delbrueckii",
            "fullName": "Torulaspora delbrueckii (Yeast)"
        },
        "name": "tRNA-splicing endonuclease subunit Sen15 domain-containing protein",
        "description": null,
        "length": 124,
        "sequence": "MPIDGDAGSIVTLVRNNLAHYQLWADVVISDRTMAWRDQTLCLITGRPTQKLSHDDEDEIATEYVLPVEMSQYKGGYVTLECLDKVFDQLCPTTAKRLTLAIVNDDGTVAFYFVYKGLHKPKRN",
        "proteome": "UP000005627",
        "gene": "TDEL0B07180",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006388",
                "name": "tRNA splicing, via endonucleolytic cleavage and ligation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000379",
                "name": "tRNA-type intron splice site recognition and cleavage",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000214",
                "name": "tRNA-intron endonuclease complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "e1b9d2379cf79ef1d8698f97ff7972933c49cee1",
        "counters": {
            "domain_architectures": 2657,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2657
        }
    }
}