GET /api/protein/UniProt/G8ZMQ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G8ZMQ5",
"id": "G8ZMQ5_TORDE",
"source_organism": {
"taxId": "4950",
"scientificName": "Torulaspora delbrueckii",
"fullName": "Torulaspora delbrueckii (Yeast)"
},
"name": "Ribonuclease T2-like",
"description": [
"Rnase which modulates cell survival under stress conditions. Released from the vacuole to the cytoplasm during stress to promote tRNA and rRNA cleavage and to activate separately a downstream pathway that promotes cell death. Involved in cell size, vacuolar morphology and growth at high temperatures and high salt concentration"
],
"length": 432,
"sequence": "MYIKNFLPFLQSPAQFWNLKGGDKPFAPHCPIDLPLSCQNHTDIQDSCCFEYPGGIFLQTQFWDYVPSRSGLDDDELEKQLGPLDSFTIHGLWPDNCRGGFEQFCDDSLAIDDVYYLLNSDQFNNDKVNLEISGKDLLAELNRLWKSNNGNDESLWIHEYNKHGTCIKTIRPSCYSRWNDDSVIENATDLKKQSVYDYFRVAYNVHKKLDSFKVLKEEGIEPSLKKTYTRDEIQAALNKGFKDHNVYFACDRHQALNEVWYYHVLQGSLLGEEFKPIDTLRTGLSRCPDKGIKFYPKGYIPSGNGGGGHNGRQLRGIIRLSGYEGFLIKNGRWMIKGTPANFLLLKAPFGGYHLKSRTGYCGVSEDGLLTCNKHVGNAGQFDYNAEKGGYLGYSGSSEWGATNLPRGNIQSFVYLKGDIPKPYEFKLKFIKS",
"proteome": "UP000005627",
"gene": "TDEL0A05670",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033897",
"name": "ribonuclease T2 activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b34f7580cfad4e33640d806ea258f7d01f80a827",
"counters": {
"domain_architectures": 1090,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 2,
"panther": 1,
"prosite": 2,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1090
}
}
}