General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G8X7K5",
        "id": "G8X7K5_FLACA",
        "source_organism": {
            "taxId": "1041826",
            "scientificName": "Flavobacterium columnare (strain ATCC 49512 / CIP 103533 / TG 44/87)",
            "fullName": "Flavobacterium columnare (strain ATCC 49512 / CIP 103533 / TG 44/87)"
        },
        "name": "2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase",
        "description": [
            "Catalyzes the transfer of pyrophosphate from adenosine triphosphate (ATP) to 6-hydroxymethyl-7,8-dihydropterin, an enzymatic step in folate biosynthesis pathway"
        ],
        "length": 378,
        "sequence": "MGIQKKVILSLGSNQGEKLDHIMTCIQLIHNKIGLVLQVSKLYETPAWGFESDAFYNCAILIHTSFTPEQVLRKIGGIEKEMGRQRKKEVGYESRIIDIDIVAFDDQVLNTENLIIPHLHMQNRRFVLYPMKDLGVEWVHPVLCKNIDRLLLDCPDTSSCEVVAELTAPIKQFDVDKLNYIAIEGNIGAGKTTLASKIAADFNAKLVLERFADNPFLPKFYKDQGRYAFPLEMSFLADRYQQLADDLSQFDLFADFVVADYHIFKSLIFAKVTLQGDEFRLYKTLFDIIYKEMPKPDLYVYLYQNTDRLLKNIKKRGRSYEQEIPAEYLDKINKGYLDYIKTQLGLNVLVIDVSDLDFVKRQEDYVIILQKIQEKLNC",
        "proteome": "UP000005638",
        "gene": "FCOL_04435",
        "go_terms": [
            {
                "identifier": "GO:0003848",
                "name": "2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009396",
                "name": "folic acid-containing compound biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "301f96e8c5accb74213fd7725488046478ea8a33",
        "counters": {
            "domain_architectures": 854,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 2,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 854
        }
    }
}