GET /api/protein/UniProt/G8HSI1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G8HSI1",
        "id": "G8HSI1_9CONI",
        "source_organism": {
            "taxId": "120593",
            "scientificName": "Halocarpus kirkii",
            "fullName": "Halocarpus kirkii"
        },
        "name": "Potassium/proton antiporter CemA",
        "description": [
            "Contributes to K(+)/H(+) antiport activity by supporting proton efflux to control proton extrusion and homeostasis in chloroplasts in a light-dependent manner to modulate photosynthesis. Prevents excessive induction of non-photochemical quenching (NPQ) under continuous-light conditions. Indirectly promotes efficient inorganic carbon uptake into chloroplasts"
        ],
        "length": 261,
        "sequence": "MNLIPRSITRTLSRFRIELTSESRSLAIRELEVAKYKASASLRYLAGLLVLPWGISILLQKGLEPWVTNWWNTNQSQKIFDFIQEEGTLERFEKIEELFMLERMMEDSLQTDSQDPRVEIKKKMIQLVKMYNQDCIQIILHLLTNIMGSVILSTYLILGKNKLAILNSWIQELFYSLSDTIKAFYILLATDLCIGFHSPRGWELLINWIFENYGLAHNERTISVLVSTFPVILDTIFKYWIFRRLNRTSPSLVVIYHSISE",
        "proteome": null,
        "gene": "cemA",
        "go_terms": [
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8cdd9906ff33d42e8fcc85ed485734d21a182623",
        "counters": {
            "domain_architectures": 15259,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 15259
        }
    }
}