GET /api/protein/UniProt/G8HSI1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G8HSI1",
"id": "G8HSI1_9CONI",
"source_organism": {
"taxId": "120593",
"scientificName": "Halocarpus kirkii",
"fullName": "Halocarpus kirkii"
},
"name": "Potassium/proton antiporter CemA",
"description": [
"Contributes to K(+)/H(+) antiport activity by supporting proton efflux to control proton extrusion and homeostasis in chloroplasts in a light-dependent manner to modulate photosynthesis. Prevents excessive induction of non-photochemical quenching (NPQ) under continuous-light conditions. Indirectly promotes efficient inorganic carbon uptake into chloroplasts"
],
"length": 261,
"sequence": "MNLIPRSITRTLSRFRIELTSESRSLAIRELEVAKYKASASLRYLAGLLVLPWGISILLQKGLEPWVTNWWNTNQSQKIFDFIQEEGTLERFEKIEELFMLERMMEDSLQTDSQDPRVEIKKKMIQLVKMYNQDCIQIILHLLTNIMGSVILSTYLILGKNKLAILNSWIQELFYSLSDTIKAFYILLATDLCIGFHSPRGWELLINWIFENYGLAHNERTISVLVSTFPVILDTIFKYWIFRRLNRTSPSLVVIYHSISE",
"proteome": null,
"gene": "cemA",
"go_terms": [
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8cdd9906ff33d42e8fcc85ed485734d21a182623",
"counters": {
"domain_architectures": 15259,
"entries": 4,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"hamap": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 15259
}
}
}