GET /api/protein/UniProt/G8D7T9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G8D7T9",
"id": "G8D7T9_VIOSO",
"source_organism": {
"taxId": "13758",
"scientificName": "Viola sororia",
"fullName": "Viola sororia (Woolly blue violet)"
},
"name": "DNA-directed RNA polymerase",
"description": [
"DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates"
],
"length": 162,
"sequence": "ETMLGKRVDYSGRSVIVVGPSLSLHRCGLPREIAIELFQTFVIRGLIRQHFASNIGVAKSKIREKEPIVWEILQEVMQGHPVLLNRAPTLHRLGIQAFQPILVEERAICLHPLVRKGFNADFDGDQMAVHVPLSLEAQAEARLLMFSHTNLLSPAIGDPISV",
"proteome": null,
"gene": "rpoc1",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003899",
"name": "DNA-directed RNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3376c04b65c803996aca8342236c6155f0bd333f",
"counters": {
"domain_architectures": 5696,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"smart": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 5696
}
}
}