HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G8BV42",
"id": "G8BV42_TETPH",
"source_organism": {
"taxId": "1071381",
"scientificName": "Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5)",
"fullName": "Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) (Yeast)"
},
"name": "L21",
"description": [
"Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel"
],
"length": 200,
"sequence": "MSTFEPVVVIDGKGHLVGRLASTVAKQLLNGQKIVVVRAEALNISGEFFRNKLKYHDYLRKATAFNKTRGPFHFRAPSRIFYKAVRGMVSHKTARGKAAMERLKVFEGIPPPYDKKKRVVVPQALRVLRLKPGRKYTTLSKLSSAVGWKYEDVVAKLEEKRKVRSAEFYAKKKAFNKKVAAATAASAESEAAKQLATFGY",
"proteome": "UP000005666",
"gene": "TPHA0F01400",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015934",
"name": "large ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cdd933c6972e36df20e8c3059e624fe397bc606f",
"counters": {
"domain_architectures": 36205,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 36205
}
}
}