HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G8BQS4",
"id": "G8BQS4_TETPH",
"source_organism": {
"taxId": "1071381",
"scientificName": "Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5)",
"fullName": "Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) (Yeast)"
},
"name": "Small ribosomal subunit protein uS5m",
"description": [
"Component of the mitochondrial ribosome (mitoribosome), a dedicated translation machinery responsible for the synthesis of mitochondrial genome-encoded proteins, including at least some of the essential transmembrane subunits of the mitochondrial respiratory chain. The mitoribosomes are attached to the mitochondrial inner membrane and translation products are cotranslationally integrated into the membrane"
],
"length": 314,
"sequence": "MFKRQFSTSLGNLKHYGDSILKKYYSPELLNSIKLAQSVIPTKPDFKVSSNVKFHPPYLEDFSKIDSYWDYKPGLPHAHVSDVNEINTFEWDKVHQQLPGDGLIIPPGVSRNIASGSDSAKLSGRTSKTMDVALGLHKQSGLNIEYITKKLDMKPLVTKRVSNQTAKGKIASFYALVVVGDRNGMVGLGEGKSRETMSKAIFKAHWDGVRNLKEIPRYENRTIYGDIDYRYHGVKLFLRSGRPGFGLRVNHIIYEICECAGIKDLSGKVYKSRNDMNVAKGTVEALLNSQKTLDEIALGRGKKIADVRSIYYSS",
"proteome": "UP000005666",
"gene": "TPHA0C04360",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ddb47877d1b64f864fa25e376c154e201459d42b",
"counters": {
"domain_architectures": 34638,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"profile": 1,
"pfam": 2,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 34638
}
}
}