HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G7T9V7",
"id": "G7T9V7_XANOB",
"source_organism": {
"taxId": "383407",
"scientificName": "Xanthomonas oryzae pv. oryzicola (strain BLS256)",
"fullName": "Xanthomonas oryzae pv. oryzicola (strain BLS256)"
},
"name": "Ribonuclease T",
"description": [
"Trims short 3' overhangs of a variety of RNA species, leaving a one or two nucleotide 3' overhang. Responsible for the end-turnover of tRNA: specifically removes the terminal AMP residue from uncharged tRNA (tRNA-C-C-A). Also appears to be involved in tRNA biosynthesis"
],
"length": 211,
"sequence": "MNEPVDAQPAPSFLPMSRRFRGYLPVVVDVETGGFDSNKHALLEIACVPIEMDADGRFFPGDTASAHLVPAPGLEIEPKSLEITGIVLDHPFRLAKQEKDALDHVFAPVRAAVKKYGCQRAILVGHNAHFDLNFLNAAVARVGHKRNPFHPFSVFDTVTLAGVAYGQTVLARAAQAAGLDWNAADAHSAVYDTEQTARLFCKIANAWPGPV",
"proteome": null,
"gene": "rnt",
"go_terms": [
{
"identifier": "GO:0003676",
"name": "nucleic acid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004540",
"name": "RNA nuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006396",
"name": "RNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5aad122e81bfc5b649ae462596f1030cc5a1692e",
"counters": {
"domain_architectures": 85258,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"smart": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 85258
}
}
}