GET /api/protein/UniProt/G7T9V7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G7T9V7",
        "id": "G7T9V7_XANOB",
        "source_organism": {
            "taxId": "383407",
            "scientificName": "Xanthomonas oryzae pv. oryzicola (strain BLS256)",
            "fullName": "Xanthomonas oryzae pv. oryzicola (strain BLS256)"
        },
        "name": "Ribonuclease T",
        "description": [
            "Trims short 3' overhangs of a variety of RNA species, leaving a one or two nucleotide 3' overhang. Responsible for the end-turnover of tRNA: specifically removes the terminal AMP residue from uncharged tRNA (tRNA-C-C-A). Also appears to be involved in tRNA biosynthesis"
        ],
        "length": 211,
        "sequence": "MNEPVDAQPAPSFLPMSRRFRGYLPVVVDVETGGFDSNKHALLEIACVPIEMDADGRFFPGDTASAHLVPAPGLEIEPKSLEITGIVLDHPFRLAKQEKDALDHVFAPVRAAVKKYGCQRAILVGHNAHFDLNFLNAAVARVGHKRNPFHPFSVFDTVTLAGVAYGQTVLARAAQAAGLDWNAADAHSAVYDTEQTARLFCKIANAWPGPV",
        "proteome": null,
        "gene": "rnt",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004540",
                "name": "RNA nuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5aad122e81bfc5b649ae462596f1030cc5a1692e",
        "counters": {
            "domain_architectures": 85258,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 1,
                "hamap": 1,
                "ncbifam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 85258
        }
    }
}