GET /api/protein/UniProt/G7PUC7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G7PUC7",
        "id": "G7PUC7_MACFA",
        "source_organism": {
            "taxId": "9541",
            "scientificName": "Macaca fascicularis",
            "fullName": "Macaca fascicularis (Crab-eating macaque)"
        },
        "name": "Cytochrome c oxidase assembly protein COX11, mitochondrial",
        "description": [
            "Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I"
        ],
        "length": 276,
        "sequence": "MGGLWYPGWRGVAFCGWRWIHPGSPARAAERVEPFLRPAWSGTGGTERGLRWLGTWKHCSLPARHPALQPPRRPKSSDPFTRAHVEEWRRRNKTTLTYVAAVAXAMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDQIENMVPVKDRILKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPIIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMINVDLITLSYTFFEAKEGHTLPVPGYN",
        "proteome": null,
        "gene": "EGM_07733",
        "go_terms": [
            {
                "identifier": "GO:0005507",
                "name": "copper ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "ae98d40326e5daea8525e3d731e78e958f1668d1",
        "counters": {
            "domain_architectures": 10687,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 10687
        }
    }
}