GET /api/protein/UniProt/G7PUC7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G7PUC7",
"id": "G7PUC7_MACFA",
"source_organism": {
"taxId": "9541",
"scientificName": "Macaca fascicularis",
"fullName": "Macaca fascicularis (Crab-eating macaque)"
},
"name": "Cytochrome c oxidase assembly protein COX11, mitochondrial",
"description": [
"Exerts its effect at some terminal stage of cytochrome c oxidase synthesis, probably by being involved in the insertion of the copper B into subunit I"
],
"length": 276,
"sequence": "MGGLWYPGWRGVAFCGWRWIHPGSPARAAERVEPFLRPAWSGTGGTERGLRWLGTWKHCSLPARHPALQPPRRPKSSDPFTRAHVEEWRRRNKTTLTYVAAVAXAMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDQIENMVPVKDRILKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPIIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMINVDLITLSYTFFEAKEGHTLPVPGYN",
"proteome": null,
"gene": "EGM_07733",
"go_terms": [
{
"identifier": "GO:0005507",
"name": "copper ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "ae98d40326e5daea8525e3d731e78e958f1668d1",
"counters": {
"domain_architectures": 10687,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 10687
}
}
}