GET /api/protein/UniProt/G7NQV9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G7NQV9",
"id": "G7NQV9_MACMU",
"source_organism": {
"taxId": "9544",
"scientificName": "Macaca mulatta",
"fullName": "Macaca mulatta (Rhesus macaque)"
},
"name": "dCTP pyrophosphatase 1",
"description": [
"Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for dCTP and its analogs including 5-iodo-dCTP and 5-methyl-dCTP for which it may even have a higher efficiency. May protect DNA or RNA against the incorporation of these genotoxic nucleotide analogs through their catabolism"
],
"length": 170,
"sequence": "MSVAGGEIRGDTAGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERLALQEELSDVLISLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAVSEDQAVGPADLPCDSTGQTST",
"proteome": null,
"gene": "EGK_12685",
"go_terms": [
{
"identifier": "GO:0047429",
"name": "nucleoside triphosphate diphosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009143",
"name": "nucleoside triphosphate catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ec93eb7b1b455d5f864dd21ebd6d09bf20d0d3c2",
"counters": {
"domain_architectures": 8675,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 8675
}
}
}