General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G6FYS9",
        "id": "G6FYS9_9CYAN",
        "source_organism": {
            "taxId": "741277",
            "scientificName": "Fischerella thermalis JSC-11",
            "fullName": "Fischerella thermalis JSC-11"
        },
        "name": "2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase",
        "description": [
            "Catalyzes the formation of 4-diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D-erythritol 4-phosphate (MEP)"
        ],
        "length": 229,
        "sequence": "MHLLIPAAGTGRRMGSHRNKLLLQVRSQPIIAWTLLAAQASDQISWIGIISQPHDWQDFKEIIADLQLTKPVKLIKGGSSRQESVYNGLLSLPANAEQVLIHDGARCLATPDLLNRCAEAICHCLGLIAAVPVKDTIKVVDENGIIQSTPERSQLWAAQTPQGFDVKLLKECHSQGVAHGWEVTDDAALFEKCGYQVQIVQGEETNLKVTTPQDLAIAEFILNTRFDQK",
        "proteome": "UP000004344",
        "gene": "ispD",
        "go_terms": [
            {
                "identifier": "GO:0070567",
                "name": "cytidylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050518",
                "name": "2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008299",
                "name": "isoprenoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ca7b4739094c206eca8a003001b55eae54fede06",
        "counters": {
            "domain_architectures": 20519,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "hamap": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 20519
        }
    }
}