HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G6FU29",
"id": "G6FU29_9CYAN",
"source_organism": {
"taxId": "741277",
"scientificName": "Fischerella thermalis JSC-11",
"fullName": "Fischerella thermalis JSC-11"
},
"name": "ATP synthase subunit a",
"description": [
"Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane"
],
"length": 251,
"sequence": "MLNFLNFFNSVTLAELEVGHHFYWQLGNLKLHGQVFLTSWFVIAILVVASIAATRNVQRVPSGIQNFMEYALEFIRDLTKNQLGEKEYRPWVPFIGTLFLFIFVSNWSGALIPWKLIKLPSGELAAPTNDINTTVALALLTSLAYFYAGFSKRGLGYFKKYIEPTPVLLPIAILEDFTKPLSLSFRLFGNILADELVVAVLVLLVPLFVPLPVMALGLFTSAIQALVFATLAGAYIHEAMEGHGGEEHEEH",
"proteome": "UP000004344",
"gene": "atpB",
"go_terms": [
{
"identifier": "GO:0015078",
"name": "proton transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0015986",
"name": "proton motive force-driven ATP synthesis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0045259",
"name": "proton-transporting ATP synthase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "acaa664a20e87c3445188e8a4619f81f602dd2b5",
"counters": {
"domain_architectures": 79589,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"prints": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 79589
}
}
}