General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G5SKW2",
        "id": "G5SKW2_SALET",
        "source_organism": {
            "taxId": "913086",
            "scientificName": "Salmonella enterica subsp. enterica serovar Wandsworth str. A4-580",
            "fullName": "Salmonella enterica subsp. enterica serovar Wandsworth str. A4-580"
        },
        "name": "Trifunctional NAD biosynthesis/regulator protein NadR",
        "description": [
            "This enzyme has three activities: DNA binding, nicotinamide mononucleotide (NMN) adenylyltransferase and ribosylnicotinamide (RN) kinase. The DNA-binding domain binds to the nadB operator sequence in an NAD- and ATP-dependent manner. As NAD levels increase within the cell, the affinity of NadR for the nadB operator regions of nadA, nadB, and pncB increases, repressing the transcription of these genes. The RN kinase activity catalyzes the phosphorylation of RN to form nicotinamide ribonucleotide. The NMN adenylyltransferase activity catalyzes the transfer of the AMP moiety of ATP to nicotinamide ribonucleotide to form NAD(+). The NMN adenylyltransferase domain also functions as the NAD and ATP sensor"
        ],
        "length": 410,
        "sequence": "MSSFDYLKTAIKQQGCTLQQVADASGMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFPRRQKNIGVVFGKFYPLHTGHIYLIQRACSQVDELHIIMGYDDTRDRGLFEDSAMSQQPTVSDRLRWLLQTFKYQKNIRIHAFNEEGMEPYPHGWDVWSNGIKAFMAEKGIQPSWIYTSEEADAPQYLEHLGIETVLVDPERTFMNISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLGSSVDRKAFQNLLVEMLKENNIEFVHVKEADYDGRFLRCVELVKEMMGEQG",
        "proteome": null,
        "gene": "LTSEWAN_6484",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009058",
                "name": "biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000309",
                "name": "nicotinamide-nucleotide adenylyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0050262",
                "name": "ribosylnicotinamide kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009435",
                "name": "NAD+ biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5304a62ad3b056e13d423e0b851ce3f4d5bfc031",
        "counters": {
            "domain_architectures": 592,
            "entries": 28,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 5,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "smart": 1,
                "pfam": 2,
                "cdd": 3,
                "profile": 1,
                "ncbifam": 3,
                "pirsf": 1,
                "panther": 1,
                "interpro": 10
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 592
        }
    }
}